PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_12.196
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family WRKY
Protein Properties Length: 423aa    MW: 45705.8 Da    PI: 8.1039
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_12.196genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.81.1e-33238296159
                                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                   ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  evm.model.supercontig_12.196 238 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 296
                                   59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.0E-38223298IPR003657WRKY domain
SuperFamilySSF1182901.44E-29230298IPR003657WRKY domain
PROSITE profilePS5081138.825233298IPR003657WRKY domain
SMARTSM007743.1E-39238297IPR003657WRKY domain
PfamPF031062.2E-26239296IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MDDHVSAPQQ LQLRMSDTGD PAQKPAGFDG TGAGGARYKL MSPAKLPISR SSCITIPPGL  60
SPTSFLESPV LLSNVKAEPS PTTGSLTKPQ MPHASVGSSS YLATSFEERK SSSFEFRPPP  120
KSNMPQPSRR YSAGMIMSNQ KERSDKASSL AGRDDKSSMY GQVSHTGEPN GTPDLSPGAA  180
NDENGEGAVL NRINDEFDED DPFSKRRKMD GGIEVTPVVK PIREPRVVVQ TLSEVDILDD  240
GYRWRKYGQK VVRGNPNPRS YYKCTNAGCP VRKHVERASH DPKAVITTYE GKHNHDVPTA  300
RTSSHDTSGV ALNGASRLRP EENDAISLDL GVGISSGNDN RLSEQQQVHA ELIQGQTRAN  360
TAASFRLVPA VPLASYYGVV NSGLNSHMSR EPQTEVRSVE LQPLNHSSYP YPPNMGRILS  420
GP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-38229298877Probable WRKY transcription factor 4
2lex_A4e-38229298877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007214669.11e-146hypothetical protein PRUPE_ppa003305mg
SwissprotQ93WV01e-117WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLM5X2W21e-146M5X2W2_PRUPE; Uncharacterized protein
STRINGVIT_19s0090g01720.t011e-141(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31332867
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.11e-119WRKY family protein